MenuSafe
Verified data only — every tool is pure math or cited to an official source. How we keep it trustworthy.
← All tools
📋

FDA Top-9 Allergen Reference

The 9 major US allergens and the derivative names each one hides behind on labels. Search any allergen or ingredient word.

⚠ This is a reference of names published on the lists below — not a safety verdict. A name not listed here can still indicate an allergen, and recipes change. Always read the full ingredient label and the manufacturer's “Contains” statement.
Try:
🥛

Milk

· 22 names
milkbutterbuttermilkcaseincaseinatesodium caseinatecalcium caseinatewheylactoselactalbuminlactoglobulinlactoferrinrennet caseincurdsgheecreamcustardhalf-and-halfmilk solidsnougatrecaldentdiacetyl
🥚

Egg

· 14 names
eggalbuminalbumenglobulinlivetinlysozymeovalbuminovomucinovomucoidovovitellinvitellinmayonnaisemeringuesurimi

‘Lecithin’ is usually soy but can be egg-derived — verify.

🥜

Peanut

· 10 names
peanutarachis oilgroundnutground nutbeer nutmandelonamonkey nutgooberartificial nutmixed nuts
🌰

Tree nut

· 18 names
almondwalnutcashewpecanpistachiohazelnutfilbertbrazil nutmacadamiapine nutpignolimarzipanpralinegiandujanut mealnut butternut pastenut oil
🫛

Soy

· 14 names
soysoyasoybeanedamamemisonattoshoyutamaritempehtofusoy lecithintextured vegetable proteintvphydrolyzed soy protein
🌾

Wheat / Gluten

· 19 names
wheatdurumeinkornemmerkamutspeltfarrosemolinabulgurfarinagrahamseitantriticalecouscousbranglutenvital wheat glutenhydrolyzed wheat proteinmalt

‘Malt’ is usually from barley (also gluten). Oats are gluten-free only if certified.

🐟

Fish

· 17 names
fishanchovyanchoviessurimiworcestershirecaviarroefish saucenam plafish gelatinbouillabaissecodsalmontunatilapiabasspollock
🦐

Shellfish

· 20 names
shellfishcrabcrawfishcrayfishlobsterlangousteprawnshrimpcrevettescampikrillclammusseloysterscallopsquidcalamarioctopusescargotsnail
🫘

Sesame

· 9 names
sesamebennegingellysesamolsesamumtahinihalvahhalvahummus

Sesame became the 9th FDA major allergen on Jan 1, 2023 (FASTER Act).

Frequently asked

What are the FDA top 9 food allergens?
Milk, egg, peanut, tree nut, soy, wheat, fish, shellfish and sesame — the major allergens defined by the FDA under FALCPA and the FASTER Act.
When did sesame become a major allergen?
January 1, 2023, under the FASTER Act — making sesame the 9th major US food allergen that must be declared on labels (FDA).
Is semolina a form of wheat?
Yes. Semolina is made from wheat, so it indicates the wheat allergen. Durum, spelt, farina, bulgur and couscous are also wheat (FDA / FARE).
Can a major allergen hide in "natural flavors"?
It can. If a major allergen is present it must be declared, but the safest check is the "Contains" statement plus the full ingredient list rather than relying on a single term (FDA).
Source: FDA — Food Allergies (FALCPA + FASTER Act) and FARE — Common Allergens (avoidance lists). Sesame became the 9th major allergen on Jan 1, 2023 under the FASTER Act. Informational only, not medical advice.