← All toolsSource: FDA — Food Allergies (FALCPA + FASTER Act) and FARE — Common Allergens (avoidance lists). Sesame became the 9th major allergen on Jan 1, 2023 under the FASTER Act. Informational only, not medical advice.
📋
FDA Top-9 Allergen Reference
The 9 major US allergens and the derivative names each one hides behind on labels. Search any allergen or ingredient word.
⚠ This is a reference of names published on the lists below — not a safety verdict. A name not listed here can still indicate an allergen, and recipes change. Always read the full ingredient label and the manufacturer's “Contains” statement.
Try:
🥛
Milk
· 22 namesmilkbutterbuttermilkcaseincaseinatesodium caseinatecalcium caseinatewheylactoselactalbuminlactoglobulinlactoferrinrennet caseincurdsgheecreamcustardhalf-and-halfmilk solidsnougatrecaldentdiacetyl
🥚
Egg
· 14 nameseggalbuminalbumenglobulinlivetinlysozymeovalbuminovomucinovomucoidovovitellinvitellinmayonnaisemeringuesurimi
‘Lecithin’ is usually soy but can be egg-derived — verify.
🥜
Peanut
· 10 namespeanutarachis oilgroundnutground nutbeer nutmandelonamonkey nutgooberartificial nutmixed nuts
🌰
Tree nut
· 18 namesalmondwalnutcashewpecanpistachiohazelnutfilbertbrazil nutmacadamiapine nutpignolimarzipanpralinegiandujanut mealnut butternut pastenut oil
🫛
Soy
· 14 namessoysoyasoybeanedamamemisonattoshoyutamaritempehtofusoy lecithintextured vegetable proteintvphydrolyzed soy protein
🌾
Wheat / Gluten
· 19 nameswheatdurumeinkornemmerkamutspeltfarrosemolinabulgurfarinagrahamseitantriticalecouscousbranglutenvital wheat glutenhydrolyzed wheat proteinmalt
‘Malt’ is usually from barley (also gluten). Oats are gluten-free only if certified.
🐟
Fish
· 17 namesfishanchovyanchoviessurimiworcestershirecaviarroefish saucenam plafish gelatinbouillabaissecodsalmontunatilapiabasspollock
🦐
Shellfish
· 20 namesshellfishcrabcrawfishcrayfishlobsterlangousteprawnshrimpcrevettescampikrillclammusseloysterscallopsquidcalamarioctopusescargotsnail
🫘
Sesame
· 9 namessesamebennegingellysesamolsesamumtahinihalvahhalvahummus
Sesame became the 9th FDA major allergen on Jan 1, 2023 (FASTER Act).